ZFP67 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324428
Artikelname: ZFP67 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324428
Hersteller Artikelnummer: orb324428
Alternativnummer: BYT-ORB324428-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFP67
Konjugation: Unconjugated
Alternative Synonym: anti THPOK antibody, anti ZFP67 antibody, anti ZBTB15 antibody, anti ZFP-67 antibody, anti c-KROX antibody, anti hcKROX antibody, anti ZNF857B antibody
Rabbit polyclonal antibody to ZBTB7B
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 58kDa
NCBI: 056956
UniProt: O15156
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
Target-Kategorie: ZBTB7B