ZFP67 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324428
Article Name: ZFP67 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324428
Supplier Catalog Number: orb324428
Alternative Catalog Number: BYT-ORB324428-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZFP67
Conjugation: Unconjugated
Alternative Names: anti THPOK antibody, anti ZFP67 antibody, anti ZBTB15 antibody, anti ZFP-67 antibody, anti c-KROX antibody, anti hcKROX antibody, anti ZNF857B antibody
Rabbit polyclonal antibody to ZBTB7B
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 58kDa
NCBI: 056956
UniProt: O15156
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: DLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKIIHGAGKLP
Target: ZBTB7B