ACDC Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324435
| Artikelname: |
ACDC Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324435 |
| Hersteller Artikelnummer: |
orb324435 |
| Alternativnummer: |
BYT-ORB324435-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
IHC, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ACDC |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti ACDC antibody, anti ADPN antibody, anti APM1 antibody, anti APM-1 antibody, anti GBP28 antibody, anti ACRP30 antibody, anti ADIPQTL1 antibody |
| Rabbit polyclonal antibody to ADIPOQ |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
27kDa |
| NCBI: |
004788 |
| UniProt: |
Q15848 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP |
| Target-Kategorie: |
ADIPOQ |
