ACDC Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324435
| Article Name: |
ACDC Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324435 |
| Supplier Catalog Number: |
orb324435 |
| Alternative Catalog Number: |
BYT-ORB324435-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ACDC |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ACDC antibody, anti ADPN antibody, anti APM1 antibody, anti APM-1 antibody, anti GBP28 antibody, anti ACRP30 antibody, anti ADIPQTL1 antibody |
| Rabbit polyclonal antibody to ADIPOQ |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
27kDa |
| NCBI: |
004788 |
| UniProt: |
Q15848 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP |
| Target: |
ADIPOQ |
