HR Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324439
Artikelname: HR Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324439
Hersteller Artikelnummer: orb324439
Alternativnummer: BYT-ORB324439-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HR
Konjugation: Unconjugated
Alternative Synonym: anti ALUNC antibody, anti AU antibody, anti HSA277165 antibody, anti MUHH antibody, anti MUHH1 antibody
Rabbit polyclonal antibody to HR
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 127kDa
NCBI: 005135
UniProt: O43593
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RVWAPGDAGQQKESTQKTPPTPQPSCNGDTHRTKSIKEETPDSAETPAED
Target-Kategorie: HR