HR Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324439
Article Name: HR Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324439
Supplier Catalog Number: orb324439
Alternative Catalog Number: BYT-ORB324439-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HR
Conjugation: Unconjugated
Alternative Names: anti ALUNC antibody, anti AU antibody, anti HSA277165 antibody, anti MUHH antibody, anti MUHH1 antibody
Rabbit polyclonal antibody to HR
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 127kDa
NCBI: 005135
UniProt: O43593
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RVWAPGDAGQQKESTQKTPPTPQPSCNGDTHRTKSIKEETPDSAETPAED
Target: HR