TTRAP Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324449
Artikelname: TTRAP Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324449
Hersteller Artikelnummer: orb324449
Alternativnummer: BYT-ORB324449-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TTRAP
Konjugation: Unconjugated
Alternative Synonym: anti TDP2 antibody, anti EAP2 antibody, anti AD022 antibody, anti EAPII antibody, anti TTRAP antibody, anti dJ30M3.3 antibody, anti RP1-30M3.3 antibody
Rabbit polyclonal antibody to TDP2
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 41kDa
NCBI: 057698
UniProt: O95551
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
Target-Kategorie: TDP2