TTRAP Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324449
Article Name: TTRAP Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324449
Supplier Catalog Number: orb324449
Alternative Catalog Number: BYT-ORB324449-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TTRAP
Conjugation: Unconjugated
Alternative Names: anti TDP2 antibody, anti EAP2 antibody, anti AD022 antibody, anti EAPII antibody, anti TTRAP antibody, anti dJ30M3.3 antibody, anti RP1-30M3.3 antibody
Rabbit polyclonal antibody to TDP2
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 41kDa
NCBI: 057698
UniProt: O95551
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: IPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFPSTK
Target: TDP2