IVNS1ABP Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324454
Artikelname: IVNS1ABP Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324454
Hersteller Artikelnummer: orb324454
Alternativnummer: BYT-ORB324454-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, WB
Spezies Reaktivität: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP
Konjugation: Unconjugated
Alternative Synonym: anti ND1 antibody, anti NS-1 antibody, anti NS1BP antibody, anti FLARA3 antibody, anti KLHL39 antibody, anti NS1-BP antibody, anti HSPC068 antibody
Rabbit polyclonal antibody to IVNS1ABP
Klonalität: Polyclonal
Konzentration: 1.0 mg/ml
Molekulargewicht: 72kDa
NCBI: 006460
UniProt: Q9Y6Y0
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL
Target-Kategorie: IVNS1ABP