IVNS1ABP Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324454
| Article Name: |
IVNS1ABP Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324454 |
| Supplier Catalog Number: |
orb324454 |
| Alternative Catalog Number: |
BYT-ORB324454-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human IVNS1ABP |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ND1 antibody, anti NS-1 antibody, anti NS1BP antibody, anti FLARA3 antibody, anti KLHL39 antibody, anti NS1-BP antibody, anti HSPC068 antibody |
| Rabbit polyclonal antibody to IVNS1ABP |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
72kDa |
| NCBI: |
006460 |
| UniProt: |
Q9Y6Y0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVL |
| Target: |
IVNS1ABP |