Ovol2 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: Ovol2 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324464
• Hersteller Artikelnummer: orb324464
• Alternativnummer: BYT-ORB324464-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Ovol2
• Konjugation: Unconjugated
• Alternative Synonym: anti 1700108N11Rik antibody, anti 1810007D21Rik antibody, anti M-OVO antibody, anti M-OVO-A antibody, anti M-OVO-B antibody, anti MOVO antibody, anti Ovo2 antibody, anti Zfp339 antibody, anti movo2 antibody

Produktbeschreibung

Rabbit polyclonal antibody to Ovol2

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 26kDa
• NCBI: 694455
• UniProt: Q8CIV7
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: HDAQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHNCDLCGKSFRLQRML
• Target-Kategorie: Ovol2