Ovol2 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: Ovol2 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324464
• Supplier Catalog Number: orb324464
• Alternative Catalog Number: BYT-ORB324464-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of MOUSE Ovol2
• Conjugation: Unconjugated
• Alternative Names: anti 1700108N11Rik antibody, anti 1810007D21Rik antibody, anti M-OVO antibody, anti M-OVO-A antibody, anti M-OVO-B antibody, anti MOVO antibody, anti Ovo2 antibody, anti Zfp339 antibody, anti movo2 antibody

Product Description

Rabbit polyclonal antibody to Ovol2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 26kDa
• NCBI: 694455
• UniProt: Q8CIV7
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: HDAQGTDGHLAAMQRPVARSKIKFTTGTCDNSVIHNCDLCGKSFRLQRML
• Target: Ovol2