TGFB1I1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: TGFB1I1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324475
• Hersteller Artikelnummer: orb324475
• Alternativnummer: BYT-ORB324475-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TGFB1I1
• Konjugation: Unconjugated
• Alternative Synonym: anti ARA55 antibody, anti HIC-5 antibody, anti HIC5 antibody, anti TSC-5 antibody

Produktbeschreibung

Rabbit polyclonal antibody to TGFB1I1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 48kDa
• NCBI: 057011
• UniProt: B2R8D5
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR
• Target-Kategorie: TGFB1I1

Bilder

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human Ovary (OV), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.

Human Lung

WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Lung.