TGFB1I1 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: TGFB1I1 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324475
• Supplier Catalog Number: orb324475
• Alternative Catalog Number: BYT-ORB324475-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: IHC, WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TGFB1I1
• Conjugation: Unconjugated
• Alternative Names: anti ARA55 antibody, anti HIC-5 antibody, anti HIC5 antibody, anti TSC-5 antibody

Product Description

Rabbit polyclonal antibody to TGFB1I1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 48kDa
• NCBI: 057011
• UniProt: B2R8D5
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: PEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGR
• Target: TGFB1I1

Images

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Muscle, Antibody Dilution: 1.0 ug/mL.

Positive control (+): Human Ovary (OV), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/mL.

Human Lung

WB Suggested Anti-TGFB1I1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Human Lung.