LAS1L Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: LAS1L Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324567
• Hersteller Artikelnummer: orb324567
• Alternativnummer: BYT-ORB324567-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
• Konjugation: Unconjugated
• Alternative Synonym: anti Las1-like antibody, anti dJ475B7.2 antibody

Produktbeschreibung

Rabbit polyclonal antibody to LAS1L

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 83kDa
• NCBI: 112483
• UniProt: Q9Y4W2
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
• Target-Kategorie: LAS1L

Bilder

Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in COLO205.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3.

WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.