LAS1L Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: LAS1L Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324567
• Supplier Catalog Number: orb324567
• Alternative Catalog Number: BYT-ORB324567-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LAS1L
• Conjugation: Unconjugated
• Alternative Names: anti Las1-like antibody, anti dJ475B7.2 antibody

Product Description

Rabbit polyclonal antibody to LAS1L

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 83kDa
• NCBI: 112483
• UniProt: Q9Y4W2
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: SSFGSEAKAQQQEEQGSVNDVKEEEKEEKEVLPDQVEEEEENDDQEEEEE
• Target: LAS1L

Images

Sample Type: COLO205, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in COLO205.

Sample Type: Hela, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: HT1080, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in HT1080.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/mL.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/mL.

Sample Type: Jurkat, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: MCF7, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: OVCAR-3, Antibody Dilution: 1.0 ug/mL, LAS1L is supported by BioGPS gene expression data to be expressed in OVCAR3.

WB Suggested Anti-LAS1L Antibody Titration: 0.2-1 ug/mL, Positive Control: HepG2 cell lysate.