TRIM40 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324582
| Artikelname: |
TRIM40 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324582 |
| Hersteller Artikelnummer: |
orb324582 |
| Alternativnummer: |
BYT-ORB324582-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRI40 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti TRIM40 antibody, anti RNF35 antibody, anti antibody |
| Rabbit polyclonal antibody to TRI40 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
28kDa |
| UniProt: |
Q6P9F5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE |
| Target-Kategorie: |
TRIM40 |
![]()
|
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/mL. |
