TRIM40 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324582
Article Name: TRIM40 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324582
Supplier Catalog Number: orb324582
Alternative Catalog Number: BYT-ORB324582-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TRI40
Conjugation: Unconjugated
Alternative Names: anti TRIM40 antibody, anti RNF35 antibody, anti antibody
Rabbit polyclonal antibody to TRI40
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 28kDa
UniProt: Q6P9F5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE
Target: TRIM40
Sample Type: Jurkat Whole Cell lysates, Antibody Dilution: 1 ug/mL.