DDX48 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: DDX48 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324643
• Hersteller Artikelnummer: orb324643
• Alternativnummer: BYT-ORB324643-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX48
• Konjugation: Unconjugated
• Alternative Synonym: anti DDX48 antibody, anti NUK34 antibody, anti NMP265 antibody, anti eIF4AIII antibody

Produktbeschreibung

Rabbit polyclonal antibody to EIF4A3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 45kDa
• NCBI: 055555
• UniProt: P38919
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
• Target-Kategorie: EIF4A3

Bilder

WB Suggested Anti-DDX48 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, EIF4A3 is supported by BioGPS gene expression data to be expressed in HepG2.