Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence:
Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
Target:
EIF4A3
WB Suggested Anti-DDX48 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, EIF4A3 is supported by BioGPS gene expression data to be expressed in HepG2.
* VAT and and shipping costs not included. Errors and price changes excepted