DDX48 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: DDX48 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324643
• Supplier Catalog Number: orb324643
• Alternative Catalog Number: BYT-ORB324643-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DDX48
• Conjugation: Unconjugated
• Alternative Names: anti DDX48 antibody, anti NUK34 antibody, anti NMP265 antibody, anti eIF4AIII antibody

Product Description

Rabbit polyclonal antibody to EIF4A3

Product Properties

• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Molecular Weight: 45kDa
• NCBI: 055555
• UniProt: P38919
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLV
• Target: EIF4A3

Images

WB Suggested Anti-DDX48 Antibody Titration: 1.25 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, EIF4A3 is supported by BioGPS gene expression data to be expressed in HepG2.