DHX57 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: DHX57 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324651
• Hersteller Artikelnummer: orb324651
• Alternativnummer: BYT-ORB324651-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DHX57
• Konjugation: Unconjugated
• Alternative Synonym: anti DDX57 antibody, anti FLJ32861 antibody

Produktbeschreibung

Rabbit polyclonal antibody to DHX57

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 155kDa
• NCBI: 945314
• UniProt: Q6P158
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG
• Target-Kategorie: DHX57

Bilder

WB Suggested Anti-DHX57 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, DHX57 is supported by BioGPS gene expression data to be expressed in HepG2.