DHX57 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: DHX57 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324651
• Supplier Catalog Number: orb324651
• Alternative Catalog Number: BYT-ORB324651-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DHX57
• Conjugation: Unconjugated
• Alternative Names: anti DDX57 antibody, anti FLJ32861 antibody

Product Description

Rabbit polyclonal antibody to DHX57

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 155kDa
• NCBI: 945314
• UniProt: Q6P158
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: LSGRVLQEMASLKRQFTELLSDIGFAREGLRAREIEKRAQGGDGVLDATG
• Target: DHX57

Images

WB Suggested Anti-DHX57 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate, DHX57 is supported by BioGPS gene expression data to be expressed in HepG2.