Rhox8 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324664
Artikelname: Rhox8 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324664
Hersteller Artikelnummer: orb324664
Alternativnummer: BYT-ORB324664-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rhox8
Konjugation: Unconjugated
Alternative Synonym: anti Tox antibody
Rabbit polyclonal antibody to Rhox8
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 36kDa
NCBI: 001004193
UniProt: Q6VSS7
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE
Target-Kategorie: Rhox8
Sample Type: Mouse Testis lysates, Antibody Dilution: 1.0 ug/mL.