Rhox8 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324664
Article Name: Rhox8 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324664
Supplier Catalog Number: orb324664
Alternative Catalog Number: BYT-ORB324664-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Rhox8
Conjugation: Unconjugated
Alternative Names: anti Tox antibody
Rabbit polyclonal antibody to Rhox8
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 36kDa
NCBI: 001004193
UniProt: Q6VSS7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: RISRSRSTVNSIHAMEPQEVTQSSLLRDDEIKESDDAAAWIVSQEMKERE
Target: Rhox8
Sample Type: Mouse Testis lysates, Antibody Dilution: 1.0 ug/mL.