CIITA Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324665
| Artikelname: |
CIITA Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324665 |
| Hersteller Artikelnummer: |
orb324665 |
| Alternativnummer: |
BYT-ORB324665-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti C2ta antibody, anti Gm9475 antibody, anti EG669998 antibody |
| Rabbit polyclonal antibody to C2ta |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
119kDa |
| NCBI: |
031601 |
| UniProt: |
Q3U2P0 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN |
| Target-Kategorie: |
CIITA |
![]()
|
WB Suggested Anti-C2TA Antibody Titration: 0.125 ug/mL, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate. |
