CIITA Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324665
| Article Name: |
CIITA Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324665 |
| Supplier Catalog Number: |
orb324665 |
| Alternative Catalog Number: |
BYT-ORB324665-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse C2TA |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti C2ta antibody, anti Gm9475 antibody, anti EG669998 antibody |
| Rabbit polyclonal antibody to C2ta |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
119kDa |
| NCBI: |
031601 |
| UniProt: |
Q3U2P0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: MALWESLQQQGEAQLLQAAEEKFTIEPFKAKSPKDVEDLDRLVQTQRLRN |
| Target: |
CIITA |
![]()
|
WB Suggested Anti-C2TA Antibody Titration: 0.125 ug/mL, ELISA Titer: 1:62500, Positive Control: NIH/3T3 cell lysate. |
