Gcm1 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324667
Artikelname: Gcm1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324667
Hersteller Artikelnummer: orb324667
Alternativnummer: BYT-ORB324667-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Gcm1
Konjugation: Unconjugated
Alternative Synonym: anti GCMa antibody, anti Gcm-rs2 antibody, anti Gcm1-rs1 antibody, anti glide antibody
Rabbit polyclonal antibody to Gcm1
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 49kDa
NCBI: 032129
UniProt: P70348
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN
Target-Kategorie: Gcm1
WB Suggested Anti-Gcm1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Heart.