Gcm1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324667
Article Name: Gcm1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324667
Supplier Catalog Number: orb324667
Alternative Catalog Number: BYT-ORB324667-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of mouse Gcm1
Conjugation: Unconjugated
Alternative Names: anti GCMa antibody, anti Gcm-rs2 antibody, anti Gcm1-rs1 antibody, anti glide antibody
Rabbit polyclonal antibody to Gcm1
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 49kDa
NCBI: 032129
UniProt: P70348
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EDPTSTLDSMKFYERCKFSSSRIYGSEEQFQPPVPGTYGDYEDLQTWNKN
Target: Gcm1
WB Suggested Anti-Gcm1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Heart.