Tsc22d4 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324688
| Artikelname: |
Tsc22d4 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324688 |
| Hersteller Artikelnummer: |
orb324688 |
| Alternativnummer: |
BYT-ORB324688-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tsc22d4 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 0610009M14Rik antibody, anti 1700023B23Rik antibody, anti AI415410 antibody, anti Thg-1pit antibody, anti Tilz2 antibody |
| Rabbit polyclonal antibody to Tsc22d4 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
40kDa |
| NCBI: |
076399 |
| UniProt: |
Q99PD5 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML |
| Target-Kategorie: |
Tsc22d4 |
![]()
|
WB Suggested Anti-Tsc22d4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Thymus. |
