Tsc22d4 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324688
| Article Name: |
Tsc22d4 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324688 |
| Supplier Catalog Number: |
orb324688 |
| Alternative Catalog Number: |
BYT-ORB324688-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Tsc22d4 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 0610009M14Rik antibody, anti 1700023B23Rik antibody, anti AI415410 antibody, anti Thg-1pit antibody, anti Tilz2 antibody |
| Rabbit polyclonal antibody to Tsc22d4 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
40kDa |
| NCBI: |
076399 |
| UniProt: |
Q99PD5 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML |
| Target: |
Tsc22d4 |
![]()
|
WB Suggested Anti-Tsc22d4 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: Mouse Thymus. |
