Mri1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324691
| Artikelname: |
Mri1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324691 |
| Hersteller Artikelnummer: |
orb324691 |
| Alternativnummer: |
BYT-ORB324691-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2410018C20RIK |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 2410018C20Rik antibody |
| Rabbit polyclonal antibody to Mri1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
41kDa |
| NCBI: |
080699 |
| UniProt: |
Q9CQT1 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL |
| Target-Kategorie: |
Mri1 |
![]()
|
WB Suggested Anti-Mri1 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate. |
