Mri1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324691
Article Name: Mri1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324691
Supplier Catalog Number: orb324691
Alternative Catalog Number: BYT-ORB324691-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2410018C20RIK
Conjugation: Unconjugated
Alternative Names: anti 2410018C20Rik antibody
Rabbit polyclonal antibody to Mri1
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 41kDa
NCBI: 080699
UniProt: Q9CQT1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL
Target: Mri1
WB Suggested Anti-Mri1 Antibody Titration: 2.5 ug/mL, ELISA Titer: 1:1562500, Positive Control: NIH/3T3 cell lysate.