Lbxcor1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324712
| Artikelname: |
Lbxcor1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324712 |
| Hersteller Artikelnummer: |
orb324712 |
| Alternativnummer: |
BYT-ORB324712-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Lbxcor1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti 4931440A04 antibody, anti AV273001 antibody, anti C230094B15Rik antibody, anti Corl1 antibody, anti Lbxcor1 antibody |
| Rabbit polyclonal antibody to Skor1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
100kDa |
| NCBI: |
766034 |
| UniProt: |
Q8BX46 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ |
| Target-Kategorie: |
Skor1 |
![]()
|
WB Suggested Anti-Lbxcor1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Kidney. |
