Lbxcor1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324712
| Article Name: |
Lbxcor1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324712 |
| Supplier Catalog Number: |
orb324712 |
| Alternative Catalog Number: |
BYT-ORB324712-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of mouse Lbxcor1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti 4931440A04 antibody, anti AV273001 antibody, anti C230094B15Rik antibody, anti Corl1 antibody, anti Lbxcor1 antibody |
| Rabbit polyclonal antibody to Skor1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
100kDa |
| NCBI: |
766034 |
| UniProt: |
Q8BX46 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ |
| Target: |
Skor1 |
![]()
|
WB Suggested Anti-Lbxcor1 Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Kidney. |
