Zkscan17 Rabbit Polyclonal Antibody, Unconjugated

Artikelnummer: BYT-ORB324715
Artikelname: Zkscan17 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer: BYT-ORB324715
Hersteller Artikelnummer: orb324715
Alternativnummer: BYT-ORB324715-100
Hersteller: Biorbyt
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Konjugation: Unconjugated
Alternative Synonym: anti BC040205 antibody, anti D130067D09 antibody, anti MGC36538 antibody, anti Nizp1 antibody, anti Zfp496 antibody, anti Znf496 antibody, anti RP23-210M6.6 antibody
Rabbit polyclonal antibody to Zkscan17
Klonalität: Polyclonal
Konzentration: 0.5 mg/ml
Molekulargewicht: 66kDa
NCBI: 766529
UniProt: Q5SXI5
Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequenz: Synthetic peptide located within the following region: GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP
Target-Kategorie: Zkscan17
WB Suggested Anti-Zkscan17 Antibody Titration: 0.2-1 ug/mL, Positive Control: SP2/0 cell lysate.