Zkscan17 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324715
Article Name: Zkscan17 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324715
Supplier Catalog Number: orb324715
Alternative Catalog Number: BYT-ORB324715-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Unconjugated
Alternative Names: anti BC040205 antibody, anti D130067D09 antibody, anti MGC36538 antibody, anti Nizp1 antibody, anti Zfp496 antibody, anti Znf496 antibody, anti RP23-210M6.6 antibody
Rabbit polyclonal antibody to Zkscan17
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 66kDa
NCBI: 766529
UniProt: Q5SXI5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP
Target: Zkscan17
WB Suggested Anti-Zkscan17 Antibody Titration: 0.2-1 ug/mL, Positive Control: SP2/0 cell lysate.