TRF3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324726
| Artikelname: |
TRF3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324726 |
| Hersteller Artikelnummer: |
orb324726 |
| Alternativnummer: |
BYT-ORB324726-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TRF3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti Trf3 antibody, anti Gm348 antibody, anti RP23-263E15.2 antibody |
| Rabbit polyclonal antibody to Tbpl2 |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
39kDa |
| NCBI: |
951014 |
| UniProt: |
Q6SJ95 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR |
| Target-Kategorie: |
Tbpl2 |
![]()
|
WB Suggested Anti-TRF3 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:1562500, Positive Control: SP2/0 cell lysate. |
