TRF3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324726
| Article Name: |
TRF3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324726 |
| Supplier Catalog Number: |
orb324726 |
| Alternative Catalog Number: |
BYT-ORB324726-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse TRF3 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti Trf3 antibody, anti Gm348 antibody, anti RP23-263E15.2 antibody |
| Rabbit polyclonal antibody to Tbpl2 |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
39kDa |
| NCBI: |
951014 |
| UniProt: |
Q6SJ95 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: FHPHLGGVKKASTDFSSVDLSFLPDELTQENRDQTVTGNKLASEESCRTR |
| Target: |
Tbpl2 |
![]()
|
WB Suggested Anti-TRF3 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:1562500, Positive Control: SP2/0 cell lysate. |
