ZSCAN29 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324741
| Artikelname: |
ZSCAN29 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324741 |
| Hersteller Artikelnummer: |
orb324741 |
| Alternativnummer: |
BYT-ORB324741-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen for Anti-ZSCAN29 antibody is: synthetic peptide directed towards the middle region of Human ZSC29 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti ZNF690 antibody, anti Zfp690 antibody |
| Rabbit polyclonal antibody to ZSCAN29 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
50 kDa |
| UniProt: |
Q8IWY8 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: GRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKER |
| Target-Kategorie: |
ZSCAN29 |
![]()
|
WB Suggested Anti-ZSC29 antibody Titration: 1 ug/mL, Sample Type: Human RPMI-8226 Whole Cell. |
