ZSCAN29 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324741
| Article Name: |
ZSCAN29 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324741 |
| Supplier Catalog Number: |
orb324741 |
| Alternative Catalog Number: |
BYT-ORB324741-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen for Anti-ZSCAN29 antibody is: synthetic peptide directed towards the middle region of Human ZSC29 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ZNF690 antibody, anti Zfp690 antibody |
| Rabbit polyclonal antibody to ZSCAN29 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
50 kDa |
| UniProt: |
Q8IWY8 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: GRPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKER |
| Target: |
ZSCAN29 |
![]()
|
WB Suggested Anti-ZSC29 antibody Titration: 1 ug/mL, Sample Type: Human RPMI-8226 Whole Cell. |
