ZBED9 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: ZBED9 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324742
• Hersteller Artikelnummer: orb324742
• Alternativnummer: BYT-ORB324742-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF452
• Konjugation: Unconjugated
• Alternative Synonym: anti DKFZp434N092 antibody, anti FLJ31087 antibody, anti KIAA1925 antibody, anti MGC131782 antibody, anti MGC133310 antibody, anti MGC133311 antibody, anti SCAND3 antibody, anti ZFP38-L antibody, anti ZNF305P2 antibody, anti dJ1186N24.3 antibody, anti ZNF452 antibody

Produktbeschreibung

Rabbit polyclonal antibody to SCAND3

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 152kDa
• NCBI: 443155
• UniProt: Q6R2W3
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLSYTRELS
• Target-Kategorie: ZBED9

Bilder

WB Suggested Anti-ZNF452 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.