ZBED9 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324742
Article Name: ZBED9 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324742
Supplier Catalog Number: orb324742
Alternative Catalog Number: BYT-ORB324742-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human ZNF452
Conjugation: Unconjugated
Alternative Names: anti DKFZp434N092 antibody, anti FLJ31087 antibody, anti KIAA1925 antibody, anti MGC131782 antibody, anti MGC133310 antibody, anti MGC133311 antibody, anti SCAND3 antibody, anti ZFP38-L antibody, anti ZNF305P2 antibody, anti dJ1186N24.3 antibody, anti ZNF452 antibody
Rabbit polyclonal antibody to SCAND3
Clonality: Polyclonal
Concentration: 0.5 mg/ml
Molecular Weight: 152kDa
NCBI: 443155
UniProt: Q6R2W3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLSYTRELS
Target: ZBED9
WB Suggested Anti-ZNF452 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Human brain.