SFPI1 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: SFPI1 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324746
• Hersteller Artikelnummer: orb324746
• Alternativnummer: BYT-ORB324746-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SFPI1
• Konjugation: Unconjugated
• Alternative Synonym: anti Dis1 antibody, anti PU.1 antibody, anti Spi1 antibody, anti Dis-1 antibody, anti Spi-1 antibody, anti Sfpi-1 antibody, anti Tcfpu1 antibody, anti Tfpu.1 antibody, anti SFPI1 antibody

Produktbeschreibung

Rabbit polyclonal antibody to Spi1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 1.0 mg/ml
• Molekulargewicht: 30kDa
• NCBI: 035485
• UniProt: P17433
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSH
• Target-Kategorie: Spi1

Bilder

WB Suggested Anti-SFPI1 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Lymphnode.