SFPI1 Rabbit Polyclonal Antibody, Unconjugated

Catalog Number: BYT-ORB324746
Article Name: SFPI1 Rabbit Polyclonal Antibody, Unconjugated
Biozol Catalog Number: BYT-ORB324746
Supplier Catalog Number: orb324746
Alternative Catalog Number: BYT-ORB324746-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse SFPI1
Conjugation: Unconjugated
Alternative Names: anti Dis1 antibody, anti PU.1 antibody, anti Spi1 antibody, anti Dis-1 antibody, anti Spi-1 antibody, anti Sfpi-1 antibody, anti Tcfpu1 antibody, anti Tfpu.1 antibody, anti SFPI1 antibody
Rabbit polyclonal antibody to Spi1
Clonality: Polyclonal
Concentration: 1.0 mg/ml
Molecular Weight: 30kDa
NCBI: 035485
UniProt: P17433
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence: Synthetic peptide located within the following region: NEFENFPENHFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHTGLSH
Target: Spi1
WB Suggested Anti-SFPI1 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:312500, Positive Control: Human Lymphnode.