SMARCA3 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324756
| Artikelname: |
SMARCA3 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324756 |
| Hersteller Artikelnummer: |
orb324756 |
| Alternativnummer: |
BYT-ORB324756-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCA3 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti ZBU1 antibody, anti HLTF1 antibody, anti RNF80 antibody, anti HIP116 antibody, anti SNF2L3 antibody, anti HIP116A antibody, anti SMARCA3 antibody |
| Rabbit polyclonal antibody to HLTF |
| Klonalität: |
Polyclonal |
| Konzentration: |
1.0 mg/ml |
| Molekulargewicht: |
114kDa |
| NCBI: |
620636 |
| UniProt: |
Q14527 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL |
| Target-Kategorie: |
HLTF |
![]()
|
WB Suggested Anti-SMARCA3 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Transfected 293T. |
