SMARCA3 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324756
| Article Name: |
SMARCA3 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324756 |
| Supplier Catalog Number: |
orb324756 |
| Alternative Catalog Number: |
BYT-ORB324756-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCA3 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti ZBU1 antibody, anti HLTF1 antibody, anti RNF80 antibody, anti HIP116 antibody, anti SNF2L3 antibody, anti HIP116A antibody, anti SMARCA3 antibody |
| Rabbit polyclonal antibody to HLTF |
| Clonality: |
Polyclonal |
| Concentration: |
1.0 mg/ml |
| Molecular Weight: |
114kDa |
| NCBI: |
620636 |
| UniProt: |
Q14527 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: FIVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL |
| Target: |
HLTF |
![]()
|
WB Suggested Anti-SMARCA3 Antibody Titration: 5.0 ug/mL, ELISA Titer: 1:62500, Positive Control: Transfected 293T. |
