SUPT4H1 Rabbit Polyclonal Antibody, Unconjugated
Artikelnummer:
BYT-ORB324757
| Artikelname: |
SUPT4H1 Rabbit Polyclonal Antibody, Unconjugated |
| Artikelnummer: |
BYT-ORB324757 |
| Hersteller Artikelnummer: |
orb324757 |
| Alternativnummer: |
BYT-ORB324757-100 |
| Hersteller: |
Biorbyt |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SUPT4H1 |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
anti SPT4H antibody, anti SUPT4H antibody, anti SPT4 antibody |
| Rabbit polyclonal antibody to SUPT4H1 |
| Klonalität: |
Polyclonal |
| Konzentration: |
0.5 mg/ml |
| Molekulargewicht: |
13kDa |
| NCBI: |
003159 |
| UniProt: |
P63272 |
| Puffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Formulierung: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequenz: |
Synthetic peptide located within the following region: NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV |
| Target-Kategorie: |
SUPT4H1 |
![]()
|
WB Suggested Anti-SUPT4H1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
