SUPT4H1 Rabbit Polyclonal Antibody, Unconjugated
Catalog Number:
BYT-ORB324757
| Article Name: |
SUPT4H1 Rabbit Polyclonal Antibody, Unconjugated |
| Biozol Catalog Number: |
BYT-ORB324757 |
| Supplier Catalog Number: |
orb324757 |
| Alternative Catalog Number: |
BYT-ORB324757-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human SUPT4H1 |
| Conjugation: |
Unconjugated |
| Alternative Names: |
anti SPT4H antibody, anti SUPT4H antibody, anti SPT4 antibody |
| Rabbit polyclonal antibody to SUPT4H1 |
| Clonality: |
Polyclonal |
| Concentration: |
0.5 mg/ml |
| Molecular Weight: |
13kDa |
| NCBI: |
003159 |
| UniProt: |
P63272 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Sequence: |
Synthetic peptide located within the following region: NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV |
| Target: |
SUPT4H1 |
![]()
|
WB Suggested Anti-SUPT4H1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. |
