WDR39 Rabbit Polyclonal Antibody, Unconjugated

Produktübersicht

• Artikelname: WDR39 Rabbit Polyclonal Antibody, Unconjugated
• Artikelnummer: BYT-ORB324759
• Hersteller Artikelnummer: orb324759
• Alternativnummer: BYT-ORB324759-100
• Hersteller: Biorbyt
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WDR39
• Konjugation: Unconjugated
• Alternative Synonym: anti CIA1 antibody, anti WDR39 antibody

Produktbeschreibung

Rabbit polyclonal antibody to CIAO1

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.5 mg/ml
• Molekulargewicht: 38kDa
• NCBI: 004795
• UniProt: O76071
• Puffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Formulierung: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequenz: Synthetic peptide located within the following region: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
• Target-Kategorie: CIAO1

Bilder

WB Suggested Anti-WDR39 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat.