WDR39 Rabbit Polyclonal Antibody, Unconjugated

Product Overview

• Article Name: WDR39 Rabbit Polyclonal Antibody, Unconjugated
• Biozol Catalog Number: BYT-ORB324759
• Supplier Catalog Number: orb324759
• Alternative Catalog Number: BYT-ORB324759-100
• Manufacturer: Biorbyt
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human WDR39
• Conjugation: Unconjugated
• Alternative Names: anti CIA1 antibody, anti WDR39 antibody

Product Description

Rabbit polyclonal antibody to CIAO1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Molecular Weight: 38kDa
• NCBI: 004795
• UniProt: O76071
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Form: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: HSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQ
• Target: CIAO1

Images

WB Suggested Anti-WDR39 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate, CIAO1 is supported by BioGPS gene expression data to be expressed in Jurkat.